Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Adenylate kinase isoenzyme 1
  • GlycoProtDB:GPDB0007714
  • UniProt:Q9R0Y5
  • Gene Symbol: Ak1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
155 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MEEKLKKAKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSSGSERGKKLSAIMEKGELVPLDTVLDMLRDAMLAKVDSSNGFLIDGYPREVKQGEEFEQKIGQPTLLLYVDAGAETMTQRLLKRGETSGRVDDNEETIKKRLETYYNATEPVISFYDKRGIVRKVNAEGTVDTVFSEVCTYLDSLK

Feature

GlyTouCan Images

No data