Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Carbohydrate sulfotransferase 4
  • GlycoProtDB:GPDB0007725
  • UniProt:Q9R1I1
  • Gene Symbol: Chst4
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
328 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MMLLKKGRLLMFLGSQVIVVALFIHMSVHRHLSQREESRRPVHVLVLSSWRSGSSFVGQLFGQHPDVFYLMEPAWHVWMTFTSSTAWKLHMAVRDLLRSVFLCDMSVFDAYMNPGPRKQSSLFQWEQSRALCSAPVCDFFPAHEISSPKHCKLLCGQQPFDMVEKACRSHGFVVLKEVRFLSLQALYPLLTDPSLNLHVVHLVRDPRAVFRSREHTTIELVVDSHIVLGQHLETIKEEDQPYYAMKIICKSQVDIVKAIQTLPEALQQRYLFLRYEDLVRAPLAQTTRLYKFVGLDFLPHLQTWVHNVTRGKGMGQHAFHTNARNALNVSQAWRWSLPYEKVSQLQDACGEAMDLLGYLQVRSQQEQGNLSLDLLSSSHILGQVFREG

Feature

GlyTouCan Images

No data