Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: CD48 antigen (Fragment)
  • GlycoProtDB:GPDB0007728
  • UniProt:Q9R1N8
  • Gene Symbol: No data
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
20 17406563
22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

YKRITWLHTKNQKILEYNYNSTKTIFESEFKGRVYLEENNGALHIS

Feature

GlyTouCan Images

No data