Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3
  • GlycoProtDB:GPDB0007797
  • UniProt:Q9WUV2
  • Gene Symbol: St6galnac3
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
301 23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MACILKRKPVLVVSFIALCILLLAMRLVNDATFPLLLNCFGQPKTKWIPLPYTFRQPLRTHYGYINVRTQEPLQLNCNHCAIVSNSGQMVGQKVGEEIDHASCIWRMNNAPTKGFEEDVGYMTMVRVVSHTSVPLLLKNPDYFFKEASRTIYVIWGPFRNMRKDGNGIVYNMLKKTVDAYPDAQIYVTTEQQMTHCDRVFKDETGKDRVQSGSYLSTGWFTFILAMDACYSIHVYGMINETYCKTEGYRKVPYHYYEQGKDECNEYLLHEHAPYGGHRFITEKKVFAKWAKKHRIVFTHPNWTLS

Feature

GlyTouCan Images

No data