Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Carbonic anhydrase 14
  • GlycoProtDB:GPDB0007814
  • UniProt:Q9WVT6
  • Gene Symbol: Ca14
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
213 17406563
22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MLFFALLLKVTWILAADGGHHWTYEGPHGQDHWPTSYPECGGDAQSPINIQTDSVIFDPDLPAVQPHGYDQLGTEPLDLHNNGHTVQLSLPPTLHLGGLPRKYTAAQLHLHWGQRGSLEGSEHQINSEATAAELHVVHYDSQSYSSLSEAAQKPQGLAVLGILIEVGETENPAYDHILSRLHEIRYKDQKTSVPPFSVRELFPQQLEQFFRYNGSLTTPPCYQSVLWTVFNRRAQISMGQLEKLQETLSSTEEDPSEPLVQNYRVPQPLNQRTIFASFIQAGPLYTTGEMLGLGVGILAGCLCLLLAVYFIAQKIRKKRLGNRKSVVFTSARATTEA

Feature

GlyTouCan Images

No data