Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Allergin-1 (Fragment)
  • GlycoProtDB:GPDB0007878
  • UniProt:S4R1V2
  • Gene Symbol: Milr1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
10 23002422
20 23002422
32 23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

DFHLRISNANESGPYKCKVNVSNLMKYSQDFNFTMAKDESCPSCRLSLLLPGLLLGILVIVLVLAYLIHLKYKKGKKTQREDQSKGSGDAPAQDELYVNACKTQTEQPQEIHYATPVFKEMAPMEEEGGTDGKADYIYSELTH

Feature

GlyTouCan Images

No data