Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6
  • GlycoProtDB:GPDB0007944
  • UniProt:Z4YLR0
  • Gene Symbol: St6galnac6
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
78 22823882
23002422
86 22823882
129 22823882
23002422
153 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MMKLRGPLLGHCGSGTCWKEQRSAVFVILFALITILILYSSNSANEVFHYGSLRGRTRRPVNLKKWSFSSAYFPILGNKTLPSRCNQCVIITSSSHLLGTKLGPEIERAECTIRMNDAPTSGYSADVGNKTTFRVVAHSSVFRVLRKPQEFVNRTPETVFIFWGPPNKMQKPQGSLLRVIQRAGLMFPNMEAYAVSPARMQQFDDLFRGETGKDREKSHSWLSTGWFTMVIAVELCDHVHVYGMVPPDYCSQRPRLQRMPYHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHPSWT

Feature

GlyTouCan Images

No data