Alpha-2,8-sialyltransferase 8B (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
Alpha-2,8-sialyltransferase 8B (Fragment)
  • GlycoProtDB: GPDB0001187
  • UniProt ID: A0A0A6YVX5
  • Gene Symbol: St8sia2
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 68 22823882

Sequence

MQLQFRSWMLAALTLLVVFLIFADISEIEEEIGAEVVINGSSPPAVADRSNESLKHNIQPASSKWRHNQTLSLRIRKQILKFLDAEKDISVLKGTLKPGDIIHYIFDRDSTMNVSQNLYELLPRTSPLKNKHFQTCAIVGNSGVLLNSGCGQEIDTHSFVIRCNLAPVQEYARDVGLKTDLVTMNPSVIQRAFEDLVNATWREKLL

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0