Astrotactin-1 (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
Astrotactin-1 (Fragment)
  • GlycoProtDB: GPDB0001205
  • UniProt ID: A0A0A6YWJ9
  • Gene Symbol: Astn1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 50 17406563
22823882

Sequence

XGVRMECQSKGRCPSSCPLCHVTSSPETPAEPVLLEVTRASPIYELVTNNQTQRAAEGDYLLQAARNRLSSALDQA

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0