Antithrombin-III

Entry of glycoprotein extracted from GlycoProtDB


Summary
Antithrombin-III
  • GlycoProtDB: GPDB0001217
  • UniProt ID: A0A0A6YX49
  • Gene Symbol: Serpinc1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 8 17406563
22823882
23002422
2 47 22823882
23002422
3 67 17406563
22823882

Sequence

MTKLGACNDTLKQLMEVFKFDTISEKTSDQIHFFFAKLNCRLYRKANKSSDLVSANRLFGDKSLTFNESYQDVSEVVYGAKLQPLDFKVKSGAIQSDHQQLGS

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0