Calponin

Entry of glycoprotein extracted from GlycoProtDB


Summary
Calponin
  • GlycoProtDB: GPDB0001267
  • UniProt ID: A0A0G2JDV8
  • Gene Symbol: Cnn3
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 194 17406563
22823882

Sequence

MTHFNKGPSYGLSAEVKNKIASKYDQQAEEDLRNWIEEVTGLGIGTNFQLGLKDGIILCELINKLQPGSVKKVNESSLNWPQAKTKGFHTTIDIGVKYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTDKPFDQTTISLQMGTNKGASQAGMLAPGTRRDIYDQKLTLQPVDNSTISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYPDDYPREYQYGDDQGIDY

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0