Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 (Fragment)
  • GlycoProtDB: GPDB0001285
  • UniProt ID: A0A0G2JF56
  • Gene Symbol: St6galnac3
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 121 23002422

Sequence

XAVPTIVTCDYRQVFAAETRKHPFLRARVQSGSYLSTGWFTFILAMDACYSIHVYGMINETYCKTEGYRKVPYHYYEQGKDECNEYLLHEHAPYGGHRFITEKKVFAKWAKKHRIVFTHPNWTLS

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0