Alpha-2-macroglobulin-P (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
Alpha-2-macroglobulin-P (Fragment)
  • GlycoProtDB: GPDB0001341
  • UniProt ID: A0A0N4SUX6
  • Gene Symbol: A2m
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 24 17406563
22823882

Sequence

MVMVPSLLHAGTPEKGCLLFNHLNETVTVKVSMES

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0