C-type lectin domain family 1 member A (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
C-type lectin domain family 1 member A (Fragment)
  • GlycoProtDB: GPDB0001347
  • UniProt ID: A0A0N4SVE6
  • Gene Symbol: Clec1a
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 135 ---

Sequence

MQAKYSSTRDMLDDDDTTISLYSGTSTVTRRAEPRHSVFQFYQLSNIQQDSITEKDEKLGNMSRQLQSLQAQNRKLIETLQQVAVKLCRELYNKSGGHRCSPCPEKWKWYGDKCYQFYKESKNWQSCEYFCLADNATMLKISTQEELGSPAMAVAKPGCGQMGH

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0