Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase

Entry of glycoprotein extracted from GlycoProtDB


Summary
Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase
  • GlycoProtDB: GPDB0001348
  • UniProt ID: A0A0N4SVL1
  • Gene Symbol: St8sia1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 70 17406563
22823882

Sequence

MSPCGRALHTSRGAMAMLARKFPRTRLPVGASALCVVVLCWLYIFPVYRLPNEKEIVQGVLAQRTAWRTNQTSASLFRYLLLAVAPLQHPFLLVCRRQGRL

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0