Alpha-1-antitrypsin 1-3

Entry of glycoprotein extracted from GlycoProtDB


Summary
Alpha-1-antitrypsin 1-3
  • GlycoProtDB: GPDB0001397
  • UniProt ID: A0A0R4J0X5
  • Gene Symbol: Serpina1c
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 64 17406563
22823882
23002422
2 101 17406563
22823882
23002422

Sequence

MTPSISWGLLLLAGLCCLVPSFLAEDVQETDTSQKDQSPASHEIATNLGDFAISLYRELVHQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSEADIHKSFQHLLQTLNRPDSELQLSTGNGLFVNNDLKLVEKFLEEAKNHYQAEVFSVNFAESEEAKKVINDFVEKGTQGKIAEAVKKLDQDTVFALANYILFKGKWKKPFDPENTEEAEFHVDESTTVKVPMMTLSGMLDVHHCSTLSSWVLLMDYAGNATAVFLLPDDGKMQHLEQTLSKELISKFLLKRPRRLAQIHFPRLSISGEYNLKTLMSPLGITRIFNNGADLSGITEENAPLKLSQAVHKAVLTMDETGTEAAAATVLLAVPYSMPPIVRFDHPFLFIIFEEHTQSPLFVGKVVDPTHK

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0