Biotinidase

Entry of glycoprotein extracted from GlycoProtDB


Summary
Biotinidase
  • GlycoProtDB: GPDB0001402
  • UniProt ID: A0A0R4J131
  • Gene Symbol: Btd
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 105 17406563
22823882
2 136 17406563
22823882
3 189 17406563
22823882
4 335 17406563
22823882
23002422

Sequence

MRSRFMVCIMSGARTAPALFFLGCSALALGVSSASQEHREAEYYVAAVYEHPSVLSPNPLELVSRQEALELMKQNLDVYEQQVMAAAQKGVQIIVFPEDGIHGFNFTRTSIYPFLDFMPSPKLVRWNPCLEPFRFNDTEVLQRLSCMAIKGGMFLVANLGTKQPCLSSDPGCPQDGRYQFNTNVVFSDNGTLVDRYRKHNLYFEAAFDTPANVDLITFDTPFAGKFGVFTCFDILFFDPAVRLLRDFEVKHIVYPTAWMNQLPLLAAIEIQKAFATAFGVNVLAANIHHPTLGMTGSGIHTPLKSFWYHDMDDPKGHLIIAQVATNPQGLTGTGNTTSEMDPSHRKFLKILSGDPYCEKDAQEVHCDEAAKWNVNVPPTFHSEMMYDNFTLVPVWGTEGHLQVCSNSLCCHLLYERPTLSKELYALGVFDGLHTVHGTYYIQTCALVKCGGLGFDTCGQEITEAEGLFDFHLWGNFSTLYIFPLFLTSGMTLDTPDQLGWENDHYFLRKRGLSSGLVTAALYGRLYERK

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0