Butyrophilin-like protein 10

Entry of glycoprotein extracted from GlycoProtDB


Summary
Butyrophilin-like protein 10
  • GlycoProtDB: GPDB0001409
  • UniProt ID: A0A0R4J1C6
  • Gene Symbol: Btnl10
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 102 22823882

Sequence

MARAHPGDATLPSILVSFIFLQLLTSGNGKSDFLVLGPPHPLLAIVGQDKELPCKLSLNISAEGMELRWYRDKPSSVVHVYKNGEDVYDEQMVEYKGRTSFNGSHVARGEAAVKIHNVTVFDNGTYHCVFKEYTSHSQATLWLKVAGRGSSPRIRVTDTQDKGIRAECTSAGWYPEPKVEWLDLKGQPVSAESHFSVSASTGLVALLSIVTPQDTAVGGLTCSISNPLLPEQDTGFLAAVVKVSVSGAHTGNIGQSVQSHGSIIKSSESFSVKVP

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0