Arylsulfatase K

Entry of glycoprotein extracted from GlycoProtDB


Summary
Arylsulfatase K
  • GlycoProtDB: GPDB0001420
  • UniProt ID: A0A0R4J1N2
  • Gene Symbol: Arsk
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 499 17406563
22823882
23002422

Sequence

MPAMLLLLVSVVAALALAAPAPRTQKKRMQVNQAPNVVLVASDSFDGRLTFQPGSQVVKLPFINFMRAHGTTFLNAYTNSPICCPSRAAMWSGLFTHLTESWNNFKGLDPNYTTWMDIMEKHGYQTQKFGKVDYTSGHHSISNRVEAWTRDVAFLLRQEGRPIINLIPDKNRRRVMTKDWQNTDKAIEWLRQVNYTKPFVLYLGLNLPHPYPSPSSGENFGSSTFHTSLYWLEKVAYDAIKIPKWLTLSQMHPVDFYSSYTKNCTGKFTENEIKNIRAFYYAMCAETDAMLGEIILALHKLDLLQKTIVIYTSDHGEMAMEHRQFYKMSMYEASVHVPLLMMGPGIKANLQVPSVVSLVDIYPTMLDIAGIALPPNLSGYSLLTLLSNASANEQAFKFHRPPWILSEFHGCNANASTYMLRTGQWKYIAYADGASVQPQLFDLSLDPDELTNIATEFPEITYSLDQKLRSIVNYPKVSASVHQYNKEQFIMWKQSVGQNYSNVIAHLRWHQDWQRDPRKYENAIQHWLTAHSSPLASSPTQSTSGSQPTLPQSTSG

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0