Aminopeptidase N (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
Aminopeptidase N (Fragment)
  • GlycoProtDB: GPDB0001442
  • UniProt ID: A0A0U1RNS3
  • Gene Symbol: Anpep
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 38 17406563
22823882
23002422
2 71 17406563
22823882
23002422

Sequence

MEQYNEINAISTACSSGLKECRDLVVELYSQWMKNPNNNTIHPNLRSTVYCNAIAFGGEEEWNFAWEQFRNATLVNEADKLRSALACSKDVWILNRYLSYTLNPDYIRKQDTTSTIISIASNVAGHPLVWDFVRSNWKKLFENYGGGSFSFANLIQGVTRRFSSEFELQQLEQFKADNSATGFGTGTRALEQALEKTRANIDWVKEN

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0