Casein kinase I isoform gamma-1 (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
Casein kinase I isoform gamma-1 (Fragment)
  • GlycoProtDB: GPDB0001444
  • UniProt ID: A0A0U1RNX9
  • Gene Symbol: Csnk1g1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 82 22823882

Sequence

ATYLRYVRRLDFFEKPDYEYLRTLFTDLFERKGYTFDYAYDWVGRPIPTPVGSVHVDSGASAITRESHTHRDRPSQQQPLRNQTTSSERRGEWEIQPSRQTNTSYLTSHLAADRHGGSVQPRSLTAEWFVLGPFSHSPAPT

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0