4F2 cell-surface antigen heavy chain (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
4F2 cell-surface antigen heavy chain (Fragment)
  • GlycoProtDB: GPDB0001450
  • UniProt ID: A0A0U1RP98
  • Gene Symbol: Slc3a2
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 166 ---

Sequence

MSQDTEVDMKDVELNELEPEKQPMNAADGAAAGEKNGLVKIKVAEDETEAGVKFTGLSKEELLKVAGSPGWVRTRWALLLLFWLGWLGMLAGAVVIIVRAPRCRELPVQRWWHKGALYRIGDLQAFVGRDAGGIAGLKSHLEYLSTLKVKGLVLGPIHKNQKDEINETDLKQINPTLGSQEDFKDLLQSAKKKSIHIILDLTPNYQGQNAWFLPAQADIVATKMKEALSSW

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0