Carcinoembryonic antigen-related cell adhesion molecule 10

Entry of glycoprotein extracted from GlycoProtDB


Summary
Carcinoembryonic antigen-related cell adhesion molecule 10
  • GlycoProtDB: GPDB0001460
  • UniProt ID: A0A0U1RQ24
  • Gene Symbol: Ceacam10
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 104 22823882

Sequence

MELASAHLHKGQVPWVGLLLTASLLPSLSPPTTGQVTVEAVRPNVAEGENVLLLVHNLPRTLRAIYWYRGTTAGERNEIARFITASNKIILGPAHSDREIIYNNGSLFFQGVTKNDEGAYALDMLFQNFDHTLMPVQFNVHAKKQ

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0