CD81 antigen (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
CD81 antigen (Fragment)
  • GlycoProtDB: GPDB0001491
  • UniProt ID: A0A140LJL0
  • Gene Symbol: Cd81
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 84 22823882
23002422

Sequence

MMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQAVMDDDANNAKAVVKTFHETLNCCGSNALTTLTTTILRNSLCPSGGNILTPLLQQDCHQ

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0