BCL2/adenovirus E1B 19 kDa protein-interacting protein 3

Entry of glycoprotein extracted from GlycoProtDB


Summary
BCL2/adenovirus E1B 19 kDa protein-interacting protein 3
  • GlycoProtDB: GPDB0001539
  • UniProt ID: A0A1B0GT26
  • Gene Symbol: Bnip3
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 84 22823882

Sequence

MSQSGEENLQGSWVELHFSNGNGSSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRAEIDSHSFGEKNSTLSEEDYIERRREVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSADFLKVFLPSLLLSHLLAIGLG

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0