Adhesion G protein-coupled receptor G3 (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
Adhesion G protein-coupled receptor G3 (Fragment)
  • GlycoProtDB: GPDB0001549
  • UniProt ID: A0A1D5RLS0
  • Gene Symbol: Adgrg3
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 106 22823882
23002422

Sequence

XENWGSTVNACPRDKNIRSRGWTEPGALCPSPELKSPQMLSLHLACYSFPPNWSGSGICLGAGILRGSWELLDPCLQIPRQVMQGEDEPADGVRLPKSLFGALPGNRSAVRLAITVLDIGAGNVFKGPKLLEDKGSSVLNNRMVGLSVGQMHATGLSEPVEITFSHERQPPAMILKTGMHAQTGRPSCAIHVVYPTCTVVQGASTDGVDLPIT

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0