Cadherin-16 (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
Cadherin-16 (Fragment)
  • GlycoProtDB: GPDB0001550
  • UniProt ID: A0A1D5RM27
  • Gene Symbol: Cdh16
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 39 ---

Sequence

VVVSGVSEDPDLANRNGPYSFALGPNPTVQRDWRLQPLNDSHAYLTLALHWVEPGEYMVPVVVHHDTHMWQLQVKVIVCRCNVEGQCMRKVGRMKGMPTKLSAVGVLLGTLAAIGLTHSSHTQASFSFLCSRTWPWQGRTWISQQTACL

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0