Carboxylesterase 1C (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
Carboxylesterase 1C (Fragment)
  • GlycoProtDB: GPDB0001552
  • UniProt ID: A0A1D5RM42
  • Gene Symbol: Ces1c
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 128 17406563
22823882
23002422
2 158 22823882

Sequence

ALSAHENVVVVTIQYRLGIWGLFSTGDEHSPGNWAHLDQLAALRWVQDNIANFGGNPDSVTIFGESSGGISVSVLLPLSWADDPVLSPLGKDLFHRAISESGVVINTNVGKKNIQAVNEIIATLSQCNDTSSAAMVQCLRQKTESELLEISGKLVQYNISLSTMIDGVVLPKAPEEI

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0