Cadherin-16 (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
Cadherin-16 (Fragment)
  • GlycoProtDB: GPDB0001554
  • UniProt ID: A0A1D5RMA8
  • Gene Symbol: Cdh16
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 14 22823882

Sequence

EPDSDHVQLRLRKNLSYEAAPDHKVVVVVSNIEELVGPGPGPAATATVTILVERVVAPLKLDQESYETSIPVSTPAGSLLLTIQPSDPMSRTLSDCVSLQRGRPMYAQGGSHEGNAHETVSGGCPLGHPGSDRLHSHSCVHAPGPGKEGPGSASRQRASEGSGVNDPSSPSWEVGPSSL

Feature


Glycan Images

GlyTouCan images of glycan extracted from GlycoProtDB

G02743FN

Image from GlyTouCan

G05637SS

Image from GlyTouCan

G07132SE

Image from GlyTouCan

G09351HG

Image from GlyTouCan

G13933DE

Image from GlyTouCan

G14795PD

Image from GlyTouCan

G17013IQ

Image from GlyTouCan

G18383ZI

Image from GlyTouCan

G20861AN

Image from GlyTouCan

G21125ID

Image from GlyTouCan

G21408ZT

Image from GlyTouCan

G24858KZ

Image from GlyTouCan

G28182LP

Image from GlyTouCan

G28589EC

Image from GlyTouCan

G30118JA

Image from GlyTouCan

G32553MK

Image from GlyTouCan

G32860DL

Image from GlyTouCan

G34421AJ

Image from GlyTouCan

G34549PZ

Image from GlyTouCan

G34807PD

Image from GlyTouCan

G37535BG

Image from GlyTouCan

G38034XB

Image from GlyTouCan

G38036OL

Image from GlyTouCan

G39448FX

Image from GlyTouCan

G43311WK

Image from GlyTouCan

G45336XP

Image from GlyTouCan

G45612OA

Image from GlyTouCan

G46804HY

Image from GlyTouCan

G46902RC

Image from GlyTouCan

G47513TC

Image from GlyTouCan

G48357SY

Image from GlyTouCan

G49680BM

Image from GlyTouCan

G52182RP

Image from GlyTouCan

G53133ZY

Image from GlyTouCan

G54675NM

Image from GlyTouCan

G55193JF

Image from GlyTouCan

G56185CU

Image from GlyTouCan

G58472BZ

Image from GlyTouCan

G58609GW

Image from GlyTouCan

G59405GS

Image from GlyTouCan

G61514UE

Image from GlyTouCan

G61885YO

Image from GlyTouCan

G63277QV

Image from GlyTouCan

G65814GR

Image from GlyTouCan

G65828YT

Image from GlyTouCan

G66107GL

Image from GlyTouCan

G66522JV

Image from GlyTouCan

G68466ND

Image from GlyTouCan

G68764CR

Image from GlyTouCan

G70280CS

Image from GlyTouCan

G74082KL

Image from GlyTouCan

G74132QK

Image from GlyTouCan

G74422LK

Image from GlyTouCan

G74485ID

Image from GlyTouCan

G75366RT

Image from GlyTouCan

G77994OH

Image from GlyTouCan

G78759ZW

Image from GlyTouCan

G78920EP

Image from GlyTouCan

G79655OZ

Image from GlyTouCan

G80324IX

Image from GlyTouCan

G83435EK

Image from GlyTouCan

G85523KA

Image from GlyTouCan

G88761JB

Image from GlyTouCan

G92463DS

Image from GlyTouCan

G92474WU

Image from GlyTouCan

G93858VJ

Image from GlyTouCan

G96950YI

Image from GlyTouCan

G98949DH

Image from GlyTouCan

G99475XL

Image from GlyTouCan




Copyright © 2019    GlyCosmos Portal v1.2.0