CD11b (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
CD11b (Fragment)
  • GlycoProtDB: GPDB0001574
  • UniProt ID: A1E2I0
  • Gene Symbol: Itgam
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 129 17406563
22823882

Sequence

SHRIIGAHFSPGLQYFGQSLSGGKDLTMDGLMDLAVGAQGHLLLLRAQPVLRLEATMEFSPKKVARSVFACQEQVLKNKDAGEVRVCLRVRKNTKDRLREGDIQSTVTYDLALDPVRSRIRAFFDETKNNTRRRTQVFGLMQKCETLKLILPDCVDDSVSPII

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0