Alpha-2,8-sialyltransferase (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
Alpha-2,8-sialyltransferase (Fragment)
  • GlycoProtDB: GPDB0001575
  • UniProt ID: A1E2I1
  • Gene Symbol: St8sia1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 2 17406563
22823882

Sequence

TNQTSASLFRRQMEDCCDPAHLFAMTKMNSPMGKSLWYDGELLYSFTIDNSTYSLFPQATPFQLPLKKCAVVGNGGILKMSGCARQIDEPNFVMRCNLPPLSSEYTRDVGSKTQLVTANPSIIRQRFENLLWSRKKFVDNMKIYNHSYIYMPAFSMKTGTEP

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0