Carboxypeptidase (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
Carboxypeptidase (Fragment)
  • GlycoProtDB: GPDB0001604
  • UniProt ID: A2A5J6
  • Gene Symbol: Ctsa
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 125 22823882
2 224 22823882
23002422

Sequence

MPKLVGSEGGSVARSWIRAGASPGDVRHRLPRNCCTEAQGIWGDWFVESQNDPKNSPVVLWLNGGPGCSSLDGLLTEHGPFLIQPDGVTLEYNPYAWNLIANVLYIESPAGVGFSYSDDKMYVTNDTEVAENNYEALKDFFRLFPEYKDNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLASYEQNDNSLVYFAYYHGLLGNRLWTSLQTHCCAQNKCN

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0