ATP-binding cassette sub-family A member 8-A (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
ATP-binding cassette sub-family A member 8-A (Fragment)
  • GlycoProtDB: GPDB0001613
  • UniProt ID: A2A6R7
  • Gene Symbol: Abca8a
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 57 22823882

Sequence

MVKREINVCQQTWALLCKNLLRKKRLKRDTFLRIMDRVSLVSYMTGRKILASPNEENMTELISMRFSDVVGVIFTNAYSYNLKFIKGARIPTIKEHQDHTAHCHSYGEIIYCGLSEFWRDGFVALQAAINAAII

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0