Amphoterin-induced protein 1 (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
Amphoterin-induced protein 1 (Fragment)
  • GlycoProtDB: GPDB0001633
  • UniProt ID: A2AE38
  • Gene Symbol: Amigo1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 30 23002422

Sequence

XTIRCDTKQQGMTKVWVSPSNEQVLSQGSNGSVSVRNGDLFFKKVQVEDGGVYTCYAMGETFNETLSVELKVYNFTLHGHHDTLNTAYTTLVGCILSVVLVLIYLYLTPCRCWCRGVEKPSSHQGDSLSSSMLSTTPNHDPMAGGDKDDGFDRRVAFLEPAGPGQGQNGKLKPGNTLPVPEATGLFPPLCTPGWQTSEPMGSITRQ

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0