Anoctamin (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
Anoctamin (Fragment)
  • GlycoProtDB: GPDB0001650
  • UniProt ID: A2AHK9
  • Gene Symbol: Ano3
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 111 17406563
22823882

Sequence

GAYKSSLPIKTHGPQNNRHLLYERWARWGMWYKHQPLDLIRMYFGEKIGLYFAWLGWYTGMLIPAAVVGLCVFFYGLVTMNESQVSQEICKATEVFMCPLCDKNCSLQRLNDSCIYAKVTYLFDNGGTVFFAIFMAIWAPGRICRSPFHTCCGLFETQDMNTSNIPQDPWLLIGQHMKEPV

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0