CD82 antigen (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
CD82 antigen (Fragment)
  • GlycoProtDB: GPDB0001663
  • UniProt ID: A2AIJ2
  • Gene Symbol: Cd82
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 127 17406563
22823882
2 131 17406563
22823882

Sequence

MGAGCVKVTKYFLFLFNLLFFILGAVILGFGVWILADKNSFISVLQTSSSSLQVGAYVFIGVGAITIVMGFLGCIGAVNEVRCLLGLYFVFLLLILIAQVTVGVLFYFNADKLKKEMGNTVMDIIRNYTANATSSREEAWDYVQAQ

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0