Beta-1,6-N-acetylglucosaminyltransferase B

Entry of glycoprotein extracted from GlycoProtDB


Summary
Beta-1,6-N-acetylglucosaminyltransferase B
  • GlycoProtDB: GPDB0001745
  • UniProt ID: A2IQH4
  • Gene Symbol: Gcnt2
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 69 22823882
23002422
2 315 23002422
3 389 23002422

Sequence

MGSWKYSLFSLSLIAALMLMFMYDRKLWKNYHFPRAVSNISVLAEVCLQMFSGESFYTADSARKTTLENFTCPEYKIQNHYITETLSEEEARFPLAFTLTIHKDYDTFERLFRAIYMPQNVYCVHVDSKATDTFKEAVRQLLSCFPNAFLASRMEPVVYGGFSRLQADLNCMKDLVASKIPWKYVLNTCGQDFPLKTNKEIVQYLKRFIGKNLTPGVLPPAHAVGRTKYVHQELLDHKNPYVHNTARLKAPPPHNLTIYFGTAYVALTREFANFVLKDQRSVDLISWSKDTYSPDEHFWVTLNRIPGVPGSMPPNASWTGNLRAVKWMDMEAKHGGCHGHYVHGICIYGNGDLQWLINSQSLFANKFELNTYPLTVECLELRLRERTLNQSEIAIQPSWYF

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0