Beta-1,6-N-acetylglucosaminyltransferase A

Entry of glycoprotein extracted from GlycoProtDB


Summary
Beta-1,6-N-acetylglucosaminyltransferase A
  • GlycoProtDB: GPDB0001746
  • UniProt ID: A2IQH5
  • Gene Symbol: Gcnt2
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 315 23002422
2 389 23002422

Sequence

MPPSVRYFFIVSVTTVIVFIVLYVLSFGGDQSYQKLNISDSVRLSQVCSSFIDGKSRFLWRNKLMIHEKPSCTEYVTQSHYITAPLSQEEVDFPLAYVMVIHHNFDTFARLFRAIFMPQNIYCVHVDEKATAEFKGAVEQLVSCFPNAFLASKMEPVVYGGISRLQADLNCIKDLSTSEVPWKYAINTCGQDFPLKTNKEIVQYLKGLKGKNLTPGVLPPAHAIGRTRYVHREHLSKELSYVIRTTALKPPPPHNLTIYFGSAYVALSREFANFVLRDPRAVDLLHWSKDTFSPDEHFWVTLNRIPGVPGSMPPNASWTGNLRAVKWMDMEAKHGGCHGHYVHGICIYGNGDLQWLINSQSLFANKFELNTYPLTVECLELRLRERTLNQSEIAIQPSWYF

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0