A disintegrin and metallopeptidase domain 34

Entry of glycoprotein extracted from GlycoProtDB


Summary
A disintegrin and metallopeptidase domain 34
  • GlycoProtDB: GPDB0001755
  • UniProt ID: A2RSG8
  • Gene Symbol: Adam34
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 546 22823882

Sequence

MSGAKALVHKRNMFLKFCLWTMFFFSAWSSIGHAKYSSLPEVVTPLRVTVTRGNNISPGWLSYSLNIEGQRHIITMKPKKNLISRNFLLFTYSDQGDLLEEQPFVQNDCYYHGYVDEDPESLVIVNTCFGSLQGTLEINGTTYEIMPKSTTSTFEHLAYKMDNGESEPSPMRCGLSEEEIAQQMKLQESNASTLLQIPYENWWTHHRFIDYFVVIDHNRYVHRNNNTTTCIQDMLQVVNGINGYYLQIQTDVVLTKLEVWSQNNLINVEQEIRKVLGAFCNWKINAIGNRVRHDIIHLFVRRSYGTYLGLANVGTVCLTLNCAVNSFLSDSLSDMAFIIAHEMGHNLGMMHDGSSCTCGLSSCIMAPYKSNSPKFSNCSYEEMFSVVTKRSCLYDIPDALKTINLMPTMCGNNLVEEGEECDCGSTESCLQDPCCSSDCVLKPGAQCAFGLCCKNCQFLKTGTVCREEKNECDLPEWCNGTSAECPGDVYKADGIPCSGEGYCYKMECHQRDEQCRKIFGNGSRSADEICYMEMNRRGDRFGNCGNDSSMYRRCNLADVLCGRIQCENVIQLPQRRNHETVHYTHFSNVTCWTTDYHFGITIDDVGAVSDGTTCGPDYLCVHRKCVSKSVLVRNCTPQLCHMQGVCNNKDHCHCNNTWEPPDCQLRGHGGSIDSGPPPVPLSPSNWSMYFLAFIIMYVLGFIALYGIRELKKKS

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0