Aspartylglucosaminidase

Entry of glycoprotein extracted from GlycoProtDB


Summary
Aspartylglucosaminidase
  • GlycoProtDB: GPDB0001760
  • UniProt ID: A2RSS6
  • Gene Symbol: Aga
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 310 22823882

Sequence

MERKSNLSLLLLLLVLGMPLVRGSSPLPLVVNTWPFKNATEAAWWTLLSGGSALDAVENGCAVCEKEQCDGTVGFGGSPDEGGETTLDAMIMDGTAMDVGAVGGLRRIKNAIGVARRVLEHTTHTLLVGDSATKFAESMGFTNEDLSTKTSRDLHSDWLSRNCQPNYWRNVIPDPSKYCGPYKPSGFLKQSISPHKEEVDIHSHDTIGMVVIHKTGHTAAGTSTNGIKFKIPGRVGDSPIPGAGAYADDTAGAAAATGDGDTLLRFLPSYQAVEYMRGGDDPAIACQKVILRIQKYYPNFFGAVICASVNGSYGAACNKLPTFTQFSFMVSNSLHNEPTEKKVDCI

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0