Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase-like protein MGAT4E

Entry of glycoprotein extracted from GlycoProtDB


Summary
Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase-like protein MGAT4E
  • GlycoProtDB: GPDB0001798
  • UniProt ID: A6H684
  • Gene Symbol: Mgat4e
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 264 22823882

Sequence

MEGGLRTGRLPKAPELSLQSFPSEWSWVWTYPLFHKLAAFACHASQAWLTVGITSESREGPNGLLDTLASLYHTSSTSEQKQMTVLVHLADSDPTWLRRTIIRISSLYRSQILTGQLLLIHAPPDAYPAVNDAQNKVSRGQIYSKQNVDHAFLMSFATKLSTYFLLIEDNVFCAPNFVNHIRSKVGYRKPNTWVLLEFSNMGFLGKLLHSRDLPLLAHFLLLFHKERPLNWLLLHFRTLLGQQSSILCRPFLFYHRLTHLTFENKTLIGHEKDPPDPYTLSGTVYTDMRFSDTHSPQEAYTLDESFFWSYNVTTGNYLTVILNNPANLNRVQVRTGSITDGKYILEKGQVELGYDPEGTPPQCTSFTLLGRLVQGQMDQFILESIGYKVSCVKLAVNANQVGGLMIRHIYIWGENAKNRKDVQIDNDDDDDDDDYDDDS

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0