Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B (Fragment)
  • GlycoProtDB: GPDB0001827
  • UniProt ID: A8Y5H5
  • Gene Symbol: Mgat4b
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 95 22823882

Sequence

MGPLKGTGSRRPHCLLFSFPPNTWVTTRDQPQPQVVGKRTRDVVDIYQREFLALRDRLHAAEQESLKRSKELNLVLEEIKRAVSERQALRDGEGNRTWGRLTEDPRLKPWNVSHRHVLHLPTVFHHLPHLLAKESSLQPAVRVGQGRT

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0