ATPase Na+/K+ transporting beta 1 polypeptide (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
ATPase Na+/K+ transporting beta 1 polypeptide (Fragment)
  • GlycoProtDB: GPDB0001835
  • UniProt ID: B0LAB6
  • Gene Symbol: Atp1b1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 12 17406563
22823882
23002422

Sequence

YLQPLLAVQFTNLTVDTEIRVECKAYGENIG

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0