Asialoglycoprotein receptor 2 (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
Asialoglycoprotein receptor 2 (Fragment)
  • GlycoProtDB: GPDB0001847
  • UniProt ID: B1AR35
  • Gene Symbol: Asgr2
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 165 23002422

Sequence

MEKDCQDIQQLDSEENDHQLSGDDEHGSHVQDPRIENPHWKGQPLSRPFPQRLCSTFRLSLLALAFNILLLVVICVVSSQSIQLQEEFRTLKETFSNFSSSTLMEFGALDTLGGSTNAILTSWLAQLEEKQQQLKADHSTLLFHLKHFPMDLRTLTCQLAYFQSNGTECCPVNWVEFGGSCYWFSRDGLTWAEADQYCQLENAHLLVINSREEQDFVVKHRSQFHI

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0