60S ribosomal protein L26 (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
60S ribosomal protein L26 (Fragment)
  • GlycoProtDB: GPDB0001849
  • UniProt ID: B1ARA3
  • Gene Symbol: Rpl26
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 91 22823882

Sequence

MKFNPFVTSDRSKNRKRHFNAPSHIRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSK

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0