CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase (Fragment)
  • GlycoProtDB: GPDB0001859
  • UniProt ID: B1AS81
  • Gene Symbol: St3gal3
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 64 23002422

Sequence

MFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLHCRRCIIVGNGGVLANKSLGSRIDDYDIVIRLNSAPVKGFERDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEP

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0