C-type lectin domain family 10 member A (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
C-type lectin domain family 10 member A (Fragment)
  • GlycoProtDB: GPDB0001867
  • UniProt ID: B1AU03
  • Gene Symbol: Clec10a
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 44 22823882

Sequence

SLESTVEKREQALKTDLSDLTDHVQQLRKDLKALTCQLANLKNNGSEVACCPLHWTEHEGSCYWFSESEKSWPEADKYCRLENSHLVVVNSLEEQELGPTAAR

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0