Activin receptor type-1 (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
Activin receptor type-1 (Fragment)
  • GlycoProtDB: GPDB0001876
  • UniProt ID: B1AW87
  • Gene Symbol: Acvr1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 102 22823882
23002422

Sequence

MVDGVMILPVLMMMAFPSPSVEDEKPKVNQKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLEVGLIILS

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0