Loading...

Calsperin

Entry of glycoprotein extracted from GlycoProtDB



Glycosylation Sites

# Position PubMed ID
1 42 22823882

Sequence

MVSARALLWAICVLRVALATVYFQEEFLDGERWRNRWVQSTNDSQFGHFRVSSGKFYGHKEKDKGLQTTQNSRFYAISASFKPFSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPSDLDQKKMNGKSQYYIMFGPDICGFDIKKVHVILYFKNQYHENKKPIRCKVDGFTHLYTLILRPDLSYEVKVDGQSIESGSIEYDWNLTSLRKTEKTSLDSRDWDQVEGSKVQDWEKHFLDAGASKPSDWNSELDGDWLQKPPYEDGLKAEGIDKDVWLHQKMRPAGYLTQYDLSEFENIGAIGLELWQVRSGTIFDNFLITDDEEYAEKFGKATWGETKGPEKEMDAIQAKEEVKKAREEDEEDLLMGKFHRHNHLSRFHRQGEL

Feature



Copyright © GlyCosmos Portal v1.3.0

Last updated: April 1, 2020