Ceroid-lipofuscinosis, neuronal 5

Entry of glycoprotein extracted from GlycoProtDB


Summary
Ceroid-lipofuscinosis, neuronal 5
  • GlycoProtDB: GPDB0001945
  • UniProt ID: B2RUP8
  • Gene Symbol: Cln5
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 113 22823882
2 126 22823882
3 161 22823882
4 238 17406563
22823882

Sequence

MLRGGPCGAHWRPALALALLGLATILGASPTSGQRWPVPYKRFSFRPKTDPYCQAKYTFCPTGSPIPVMKDNDVIEVLRLQAPIWEFKYGDLLGHFKLMHDAVGFRSTLTGKNYTIEWYELFQLGNCTFPHLRPDKSAPFWCNQGAACFFEGIDDKHWKENGTLSVVATISGNTFNKVAEWVKQDNETGIYYETWTVRAGPGQGAQTWFESYDCSNFVLRTYKKLAEFGTEFKKIETNYTKIFLYSGEPIYLGNETSIFGPKGNKTLALAIKKFYGPFRPYLSTKDFLMNFLKIFDTVIIHRQFYLFYNFEYWFLPMKPPFVKITYEETPLPTRHTTFTDL

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0